Protein Info for MPMX19_02817 in Azospirillum sp. SherDot2

Annotation: Serine 3-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 12 to 196 (185 residues), 160.3 bits, E=6.5e-51
• PF08659: KR
  • amino acids 15 to 190 (176 residues), 52.8 bits, E=7.3e-18
• PF13561: adh_short_C2
  • amino acids 18 to 232 (215 residues), 112.3 bits, E=4.3e-36

Best Hits

Swiss-Prot: 61% identical to SDH_AGRFC: Serine 3-dehydrogenase (sdh) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 90% identity to azl:AZL_b03320)

MetaCyc: 53% identical to sulfoacetaldehyde reductase (NADPH) (Klebsiella oxytoca TauN1)
RXN-12148 [EC: 1.1.1.313]

Predicted SEED Role

No annotation

MetaCyc Pathways

• sulfoacetaldehyde degradation III (1/1 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.313

Protein Sequence (262 amino acids)

>MPMX19_02817 Serine 3-dehydrogenase (Azospirillum sp. SherDot2)
MSNTAPKIAAQKIAIVTGATSGFGDAIARRLVAEGWRIVATGRRQDRLDALVETLGGPDV
VHPLCFDIRDEEATRAALTTLPDAFADISVLVNNAGLALGTGAAQDCDLEQWRTMIDTNV
TGLVTITRLLLARLIAQRGLIVNLASVASNWPYPGGNVYGGTKAFVKQFSLGLRSDLSAQ
GVRVTSIEPGLAESEFTLVRTGGNKAAYDALYGGANPLQPEDIAETVRWVVSLPPHVNIN
SVEIMPVSQSWAPFKIHRDTPA