Protein Info for MPMX19_02811 in Azospirillum sp. SherDot2

Annotation: Long-chain-alcohol dehydrogenase 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00465: Fe-ADH
  • amino acids 15 to 370 (356 residues), 337 bits, E=1.3e-104

Best Hits

KEGG orthology group: None (inferred from 91% identity to azl:AZL_b03380)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

• mixed acid fermentation (14/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• heterolactic fermentation (15/18 steps found)
• ethanolamine utilization (5/5 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• pyruvate fermentation to ethanol III (3/3 steps found)
• ethanol degradation I (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• L-phenylalanine degradation III (3/4 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• pyruvate fermentation to ethanol II (1/2 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• L-tyrosine degradation III (2/4 steps found)
• L-methionine degradation III (1/3 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (8/13 steps found)
• cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
• salidroside biosynthesis (1/4 steps found)
• serotonin degradation (3/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• phenylethanol biosynthesis (1/5 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Retinol metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Protein Sequence (378 amino acids)

>MPMX19_02811 Long-chain-alcohol dehydrogenase 1 (Azospirillum sp. SherDot2)
MNTIDLTTPIDLLRPPRVVFGAGTAAETGRWVRERGLTRILVVADAFNATRVERLGLEGA
VTIFADIKPEPDVPNLEALLAVAEQVEPQVVIGFGGGSAMDLAKLAAVLPGSGQTIRDVV
GPEKVAGKRAVLVQVPTTAGTGSEVGTRALVTDPATMSKLAVQSVHMLADVAVVDPDLTL
SVPAAVTAATGVDALAHCVEAYTNRKAHPLIDLYALEGIRLVGRFLPRAIADGSDREARA
GLSVASFYGGICLGPVNTAAGHAVAYPLGTRHHIPHGAANALIFPHVLAFNAPAVPAKTA
AVLEALGLPAVADPAAVFKAAHDWCVNLGCTMRLSAFGVPEADLAAMAEEAHAIRRLLDN
NPRDLSREDILGMYRAAA