Protein Info for MPMX19_02745 in Azospirillum sp. SherDot2
Annotation: putative nicotinate-nucleotide pyrophosphorylase [carboxylating]
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K03813, molybdenum transport protein [EC: 2.4.2.-] (inferred from 90% identity to azl:AZL_026910)Predicted SEED Role
"Molybdenum transport system protein ModD" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of plant hormones
- Purine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.4.2.-
Use Curated BLAST to search for 2.4.2.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (276 amino acids)
>MPMX19_02745 putative nicotinate-nucleotide pyrophosphorylase [carboxylating] (Azospirillum sp. SherDot2) MTTILPDAALDALLAQDVPYGDLTTGSLGIAARHARMSFAARGAMVLAGAEEAARLVERA GGRVLRVEPSGTAVEAGALFLEADGPAGALHHAWKVAQTLVEYASGIATRARRIVEAAPG VTVACTRKSFPGAKDLSVKAVQAGGAVMHRLGLSETLLVFPEHRAFLSDAPEAWIAALRR KAPEKKIVVEVGSMEEALAFAEAGADVIQLEKLPPAAARAVIEATRSLTPPPVVAPAGGV TEANAAAYAAAGCRLLITSAPFFGQPADVKVVLGPA