Protein Info for MPMX19_02731 in Azospirillum sp. SherDot2

Annotation: Deoxyuridine 5'-triphosphate nucleotidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00576: dUTP diphosphatase
  • amino acids 17 to 153 (137 residues), 166.9 bits, E=1.1e-53
• PF00692: dUTPase
  • amino acids 21 to 153 (133 residues), 92 bits, E=1.2e-30

Best Hits

Swiss-Prot: 69% identical to DUT_CAUVN: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K01520, dUTP pyrophosphatase [EC: 3.6.1.23] (inferred from 89% identity to azl:AZL_027130)

Predicted SEED Role

"Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC 3.6.1.23)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.23)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (11/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)
• pyrimidine deoxyribonucleotides dephosphorylation (1/3 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.23

Protein Sequence (155 amino acids)

>MPMX19_02731 Deoxyuridine 5'-triphosphate nucleotidohydrolase (Azospirillum sp. SherDot2)
MSSTLSPTVAFLRLPGNDDLPLPSYATDGAAGFDLRAAVPADAPVTLEPGKRVLVPTGFA
VGLPAGWEMQIRPRSGLAVENGVTVLNTPGTVDCDYRGPVGVCLINLGEESFAIARGDRV
AQAVIAEAPRAVLVEVASLDETARGAGGFGSTGVA