Protein Info for MPMX19_02573 in Azospirillum sp. SherDot2

Annotation: Dihydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00186: DHFR_1
  • amino acids 3 to 157 (155 residues), 164.7 bits, E=7.5e-53

Best Hits

Swiss-Prot: 44% identical to DYR_HAEIN: Dihydrofolate reductase (folA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00287, dihydrofolate reductase [EC: 1.5.1.3] (inferred from 83% identity to azl:AZL_000160)

MetaCyc: 42% identical to dihydrofolate reductase (Escherichia coli K-12 substr. MG1655)
Dihydrofolate reductase. [EC: 1.5.1.3]

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• dTMP de novo biosynthesis (mitochondrial) (2/3 steps found)
• folate transformations II (plants) (7/11 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.3

Protein Sequence (164 amino acids)

>MPMX19_02573 Dihydrofolate reductase (Azospirillum sp. SherDot2)
MLITLIVAAATNDVIGRDGRLPWSLPSDLRRFKDLTMGKPILMGRKTWESLPRRPLPGRD
NLVVSRQASIGEKDGARWFSGLGAAVSWAQASGAAELCVIGGAALFRETMPIADSLHLTR
IESAVEGDTLMPPIGAEWAEVWSSAPMEENGLIYRYIDFGKVRG