Protein Info for MPMX19_02569 in Azospirillum sp. SherDot2

Annotation: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 TIGR00136: tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA" amino acids 1 to 591 (591 residues), 789 bits, see alignment E=1.5e-241 PF01134: GIDA" amino acids 1 to 370 (370 residues), 515.9 bits, see alignment E=1.2e-158 PF21680: GIDA_C_1st" amino acids 435 to 526 (92 residues), 68.4 bits, see alignment E=1.2e-22 PF13932: GIDA_C" amino acids 531 to 586 (56 residues), 73.8 bits, see alignment 1.2e-24

Best Hits

Swiss-Prot: 71% identical to MNMG_RHORT: tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (mnmG) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03495, glucose inhibited division protein A (inferred from 95% identity to azl:AZL_000120)

Predicted SEED Role

"tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (607 amino acids)

>MPMX19_02569 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG (Azospirillum sp. SherDot2)
MGARTLLLTHKVETIGEMSCNPAIGGLAKGHLVREIDALDGVMAKAIDRGGIQFRILNRS
KGPAVRGPRAQADRKLYRQAMQALLADQENLFIEAGGAEDLIVDGEQRIVGVVTGAGESI
RAGAVVLTTGTFLRGLIHIGEERTPAGRVGEAPSIGLSDTLARLGFTLGRLKTGTPPRLD
GRTIDWDALEKQPGDLPPPPFSYMTERIDTPQIDCAITWTTPEAHALIRANLHRAPMYSG
QITGTGPRYCPSIEDKVVRFAEKEKHQIFLEPEGLDDPTVYPNGISTSLPRDVQLGILAS
MPGLEKVVMIRPGYAIEYDYVDPRELKPTLETRRAPRLFLAGQINGTTGYEEAAAQGLMA
GINAALAAGGNPDGFVLDRADAYIGVLIDDLIGRGTNEPYRMFTSRAEYRLLLRADNADQ
RLTDKGVAIGCVGSERRDVFAAKSAALSAGRALVASLQATPVELSRQGVAVNQDGVRRSG
ADLLRYPDIDLAALARLWPELGEIAPEIAEQLEIDGKYAGYLGRQEADIRAFRKDESLAL
PDDLDVDGIGSLSAEIRQKLRQSRPATLGAAARIPGMTPAALVALLRHVKRRDVASSSVA
SSGVAAE