Protein Info for MPMX19_02564 in Azospirillum sp. SherDot2

Annotation: Methylated-DNA--protein-cysteine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02870: Methyltransf_1N
  • amino acids 6 to 63 (58 residues), 38.7 bits, E=1.2e-13
• TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase
  • amino acids 66 to 145 (80 residues), 86 bits, E=6.7e-29
• PF01035: DNA_binding_1
  • amino acids 67 to 146 (80 residues), 99.9 bits, E=6e-33

Best Hits

KEGG orthology group: K00567, methylated-DNA-[protein]-cysteine S-methyltransferase [EC: 2.1.1.63] (inferred from 84% identity to azl:AZL_000070)

Predicted SEED Role

"Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Protein Sequence (165 amino acids)

>MPMX19_02564 Methylated-DNA--protein-cysteine methyltransferase (Azospirillum sp. SherDot2)
MARLSIDSPLGSLMLTGDGSALTALGWGRFDQDEPDAVLAETARQLDAYFTGRLQRFDLP
LKPAGTAFRQSVWEAMLAIPYGGTATYGGMAKMLDSGPRAVGGACGANPIPIVIPCHRVL
ASGGAPGGYSGHGGLDTKAWLLALERRHAGVGQGNGAAAEQFALL