Protein Info for MPMX19_02560 in Azospirillum sp. SherDot2

Annotation: Shikimate dehydrogenase (NADP(+))

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 TIGR00507: shikimate dehydrogenase" amino acids 14 to 280 (267 residues), 224.7 bits, see alignment E=6.3e-71 PF08501: Shikimate_dh_N" amino acids 18 to 100 (83 residues), 89.6 bits, see alignment E=1.2e-29 PF01488: Shikimate_DH" amino acids 136 to 180 (45 residues), 29.4 bits, see alignment 7.5e-11

Best Hits

Swiss-Prot: 66% identical to AROE_MAGSA: Shikimate dehydrogenase (NADP(+)) (aroE) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 91% identity to azl:AZL_000030)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.25

Use Curated BLAST to search for 1.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>MPMX19_02560 Shikimate dehydrogenase (NADP(+)) (Azospirillum sp. SherDot2)
MTAGSSGVISGKAKIAGVMGWPIGHSRSPRLHGFWLRQYGIDGAYVPLAVAPERAEQAIR
ALPALGFRGCNVTVPLKEIAFRTVDRLDGTARRMGAVNTIVVADDGALEGGNTDGFGFIE
NLRAEQPDWTAERGPAVVIGAGGAARAVVVALLDAGAPEVRLVNRTRARAEELAADLAAA
DLNSGVTVVDWVSRETALDGASLLVNTTTQGMAGQPALDLSLRALPVSAVVNDIVYVPLE
TPLLAEARTRGNPVAGGIGMLLHQARPGFKAWFGVEPQVTPDLTRFVLEG