Protein Info for MPMX19_02535 in Azospirillum sp. SherDot2

Annotation: Cytochrome c-type biogenesis protein CcmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03918: CcmH
  • amino acids 18 to 156 (139 residues), 180.3 bits, E=6.1e-58

Best Hits

Swiss-Prot: 56% identical to CCMH_BRADU: Cytochrome c-type biogenesis protein CcmH (ccmH) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 91% identity to azl:AZL_028710)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes

Protein Sequence (160 amino acids)

>MPMX19_02535 Cytochrome c-type biogenesis protein CcmH (Azospirillum sp. SherDot2)
MKRLLLAALLALSTLSPAARPALAVQPDEVLPDPALENRARTISQELRCLVCQNQSIDDS
NAPLARDLRLLVRDRLKAGDSDDKVMEYVTDRYGDYVLLRPPFKATTLVLWIGPFAVLLL
GAAGTFLFLRGRRGVAAGADTAPLSADERRRLDALLRKDD