Protein Info for MPMX19_02515 in Azospirillum sp. SherDot2

Annotation: Apolipoprotein N-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 514 to 533 (20 residues), see Phobius details PF20154: LNT_N" amino acids 36 to 200 (165 residues), 111 bits, see alignment E=6.7e-36 TIGR00546: apolipoprotein N-acyltransferase" amino acids 79 to 485 (407 residues), 322.1 bits, see alignment E=3e-100 PF00795: CN_hydrolase" amino acids 250 to 505 (256 residues), 75 bits, see alignment E=6.5e-25

Best Hits

KEGG orthology group: K03820, apolipoprotein N-acyltransferase [EC: 2.3.1.-] (inferred from 90% identity to azl:AZL_028510)

Predicted SEED Role

"Apolipoprotein N-acyltransferase (EC 2.3.1.-) / Copper homeostasis protein CutE" in subsystem Phosphate metabolism or Copper homeostasis: copper tolerance (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>MPMX19_02515 Apolipoprotein N-acyltransferase (Azospirillum sp. SherDot2)
MTATDTLPVPAKLGRVSARLAALTGWRRLAAAMLLGGFATLALPPANLMPVVLVAFPGLI
WLLDGAETKKGAFAVGWFFGFGHHLLGLYWISAALFTDIERFWWALPLSAVGLPVVLAMF
SGGATLTFQLLRRRGFGAGLGRPLLFAACWCLWEWLRGHVFTGFPWNLIGYGWVGVLPVL
QTASLIGIYGLTLVTVLVASLPAALPDRDTTPGRAGAAVAAGLALLAVLGGWGAWRLAGA
VDEPVPGVRLRLVQAAIDQRLKWAPGERVQNFQSHLALSAAAPADPSTPPPNVIIWPETA
VPFFIEDDARVRQALASVTPSGGLLITGAPRTTVDADGERRYFNGMVAVDGSGAAVADYD
KFHLVPFGEYMPLRQWLPVGAIAGNGAEFSAGPGPRTLHLGDRVAGLPPFSPLICYESIF
PGAVVDTADRPQWLLNLTNDAWYGRTAGPHQHFAINQVRAVEEGLPLVRVANTGISGVVD
SYGRVRQLLGLGERGFIDTTLPKAPVGVTAYARMGDWIFGIVLLGCFMAALASRYHR