Protein Info for MPMX19_02511 in Azospirillum sp. SherDot2

Annotation: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 4 to 444 (441 residues), 475.8 bits, see alignment E=1.5e-146 PF00919: UPF0004" amino acids 4 to 108 (105 residues), 101.6 bits, see alignment E=3.2e-33 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 4 to 441 (438 residues), 460.3 bits, see alignment E=6e-142 PF04055: Radical_SAM" amino acids 158 to 330 (173 residues), 98.7 bits, see alignment E=6.4e-32 PF01938: TRAM" amino acids 386 to 444 (59 residues), 28.7 bits, see alignment E=1.5e-10

Best Hits

Swiss-Prot: 76% identical to MIAB_RHOCS: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 92% identity to azl:AZL_028470)

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>MPMX19_02511 tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (Azospirillum sp. SherDot2)
MTKKLFIKTWGCQMNVYDSARMVDVLAPLGYRPVDEPDGADMVILNTCHIREKAAEKVFS
ELGRLRQMKDRKAEAEDGRMILAVAGCVAQAEGEEIVARAPFVDMVFGPQTYHTLPEMVA
KASRAAGSVLNTDFPAESKFDLLPEEAGSQGVAAFLAVQEGCDKFCTFCVVPYTRGAEFS
RPAGQILAEAKRLVAGGTREITLLGQNVNAWHGEGPDGATWGLGRLIRELAEIDGLARIR
YTTSHPRDMADDLIRAHAEVPQLMPYLHLPVQAGSDRVLAAMNRKHSADDYRRLVDRLRD
AKPDLAMSGDFIVGFPGETDADFAQTLKLVTEIGYAQAYSFKYSSRPGTPASAEGAQLPE
EVKEARLEALRQLLDAQQIAFNHGFVGRSVPVLFDRVGRRDGQLLGRSPWMQSVHAEADE
RLLGRIVEVRVDAARANSLAGTVVTGEYVTASPFQPAVTLEASA