Protein Info for MPMX19_02471 in Azospirillum sp. SherDot2

Annotation: Ribosomal RNA small subunit methyltransferase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 31 to 297 (267 residues), 235.3 bits, see alignment E=4.4e-74 PF00590: TP_methylase" amino acids 31 to 230 (200 residues), 109 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 53% identical to RSMI_RHILO: Ribosomal RNA small subunit methyltransferase I (rsmI) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K07056, (no description) (inferred from 96% identity to azl:AZL_028060)

MetaCyc: 44% identical to 16S rRNA 2'-O-ribose C1402 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11637 [EC: 2.1.1.198]

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.198

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>MPMX19_02471 Ribosomal RNA small subunit methyltransferase I (Azospirillum sp. SherDot2)
MDPNGPDPNGPHQSGAQGSPLAAPSKLAGGLYVVATPIGNAADITLRALDTLKRADAIAC
EDTRVTAKLMGIHGIHTPFVSYHEHNAAKMRPILIGRMKKGEAIALVTDAGTPLVSDPGY
KLVRECVAEGVAVTTLPGASAPLVALVLSGLPTDRFLFAGFLPNKSSARRATAGELKGVP
ATLVFFESPQRLPESLADLADILGPREAAVARELTKLYEEVRRGTLPELAAHYAEAGPPR
GEVVLVIGPPGEEATPGEADVDALLREALTRLSVRDAAADVAARTGQHKRTVYARALELQ
REERTK