Protein Info for MPMX19_02468 in Azospirillum sp. SherDot2

Annotation: Octopine transport system permease protein OccQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details amino acids 174 to 188 (15 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 15 to 122 (108 residues), 58.1 bits, see alignment E=5.3e-20 PF00528: BPD_transp_1" amino acids 34 to 221 (188 residues), 68.9 bits, see alignment E=2.5e-23

Best Hits

Swiss-Prot: 56% identical to NOCQ_AGRFC: Nopaline transport system permease protein NocQ (nocQ) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 86% identity to azl:AZL_028030)

Predicted SEED Role

"Arginine ABC transporter, permease protein ArtQ" in subsystem Arginine and Ornithine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>MPMX19_02468 Octopine transport system permease protein OccQ (Azospirillum sp. SherDot2)
MLELLSFGPNGWGGQLLMGTAMTVAVAVSAFAFGILVGSLGASAKLSHSLALNVVADVYT
TIVRGIPELLVIYLLFFGGSGVATSIASAFGYDGRVDLNAFTIGVLAVGLISGAYSTEVI
RGAVQSVPFGQIEAARACGMSRWLILRRVLVPQTLRFALPGLGNVWQLTLKDTALVSVTA
LAELMRITHLAAGATRQPFLFYSTAAVLYLMLTTISTALFNRAEISANRGVRRA