Protein Info for MPMX19_02425 in Azospirillum sp. SherDot2

Annotation: Malonyl-[acyl-carrier protein] O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF13489: Methyltransf_23" amino acids 31 to 199 (169 residues), 45.2 bits, see alignment E=1.7e-15 PF08242: Methyltransf_12" amino acids 55 to 148 (94 residues), 50.4 bits, see alignment E=6.1e-17 PF08241: Methyltransf_11" amino acids 55 to 149 (95 residues), 60.5 bits, see alignment E=4e-20 PF13649: Methyltransf_25" amino acids 55 to 146 (92 residues), 47.3 bits, see alignment E=5.5e-16

Best Hits

Swiss-Prot: 46% identical to NDUF5_PONAB: Arginine-hydroxylase NDUFAF5, mitochondrial (NDUFAF5) from Pongo abelii

KEGG orthology group: None (inferred from 94% identity to azl:AZL_001590)

Predicted SEED Role

"SAM-dependent methyltransferase, BioC-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>MPMX19_02425 Malonyl-[acyl-carrier protein] O-methyltransferase (Azospirillum sp. SherDot2)
MTSPDSMTVFDRALVRRRRDRAVAEFTDHAFLFEEIADRLADRLEDVIRPFPLALDIGCH
DGAMGRILKGRKGIERLVACDLSPDFARAALDPSNPAVAATVAADEEFLPFAPGSFDLAV
SNLSLHWVNDLPGALVQIRQALKPDGFFCASMLGGQTLAELRRCLYEAEMEVSGGVSPRV
SPFAEIKDAGGLLQRAGFALPVVDSDVITVTYSDAFALMRELRGMGETNAVLARRKVPAT
RSMLFDAARRYAELYAEPDGRIPVTFEVLYLAGWSPHESQQQPLKPGSGQVPLGDALKGG
GIH