Protein Info for MPMX19_02389 in Azospirillum sp. SherDot2
Annotation: putative oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to Y1144_MYCTU: Uncharacterized oxidoreductase Rv1144 (Rv1144) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: None (inferred from 95% identity to azl:AZL_001940)MetaCyc: 59% identical to 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (Pseudomonas putida)
3-hydroxy-2-methylbutyryl-CoA dehydrogenase. [EC: 1.1.1.178]
Predicted SEED Role
No annotation
MetaCyc Pathways
- L-isoleucine degradation I (4/6 steps found)
- 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
- propanoate fermentation to 2-methylbutanoate (3/6 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.1.1.178
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (253 amino acids)
>MPMX19_02389 putative oxidoreductase (Azospirillum sp. SherDot2) MNIQGLSAIVTGGASGMGAATARHLAGLGAKVTVLDVNEDAVLKTAHEIGGLGLVCDVTD GASAERALDQARSAHGPARIAVNCAGIAPAQRIVGRDGPMPLENFRSVIEVNLIGSFNIL RLAAADMAKLDPLDSGERGVIVNTASVAAYEGQIGQAAYAASKGGIVALTICAARDLARH GIRVMTVAPGLIGTPMLLNMPQEVQDSLAATVPFPKRFGKPEEYARLVQHILENEMLNGD VIRLDGAIRMAPQ