Protein Info for MPMX19_02375 in Azospirillum sp. SherDot2

Annotation: Methylthioribose-1-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase" amino acids 16 to 349 (334 residues), 420.4 bits, see alignment E=4.6e-130 TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins" amino acids 38 to 348 (311 residues), 292.2 bits, see alignment E=4.2e-91 PF01008: IF-2B" amino acids 51 to 348 (298 residues), 202.6 bits, see alignment E=3.9e-64

Best Hits

Swiss-Prot: 71% identical to MTNA_RHORT: Methylthioribose-1-phosphate isomerase (mtnA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 89% identity to azl:AZL_002040)

MetaCyc: 71% identical to methylthioribose-1-phosphate isomerase (Rhodospirillum rubrum)
S-methyl-5-thioribose-1-phosphate isomerase. [EC: 5.3.1.23]; 5.3.1.23 [EC: 5.3.1.23]

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>MPMX19_02375 Methylthioribose-1-phosphate isomerase (Azospirillum sp. SherDot2)
MRIDGTAYRTIWPDGEGVVAIIDQTKLPHDFAVVRLTSLEEAAHAIRAMLVRGAPLIGAA
AAYGVALALRTEASDHGLEQACTTLLATRPTAVNLRWALERMRRRLAPLPASQRIGAAEA
EAAAIADEDVEINRSIGLHGAALIRAAAARKAPGEPVNVLTHCNAGWLATVDWGTALAPV
YAAFEQGIPLHVWVDETRPRNQGASLTAWELQQHGVPHTVIADNVGGHLMQHGKVDLCIV
GTDRTTATGDVCNKIGTYLKALAAHDNGVPFYVGLPSPTIDWTIADGVREIPIEERDGRE
VSELTGRTADGRIETVRVTPDGSPVANYAFDVTPARLVTGLITERGVCAASREGLLGLFP
ERG