Protein Info for MPMX19_02356 in Azospirillum sp. SherDot2

Annotation: Replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 TIGR00665: replicative DNA helicase" amino acids 8 to 465 (458 residues), 398.2 bits, see alignment E=2.2e-123 PF00772: DnaB" amino acids 8 to 109 (102 residues), 93.1 bits, see alignment E=2.1e-30 PF03796: DnaB_C" amino acids 186 to 463 (278 residues), 272.6 bits, see alignment E=6.1e-85 PF06745: ATPase" amino acids 188 to 377 (190 residues), 32.9 bits, see alignment E=8.6e-12 PF13481: AAA_25" amino acids 195 to 362 (168 residues), 41.3 bits, see alignment E=2.7e-14

Best Hits

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>MPMX19_02356 Replicative DNA helicase (Azospirillum sp. SherDot2)
MADAPRTPPHNEEAEQALLGALLVKNAAHAKVADFLRPEHFHDPAHQRIFAAIVETIGAG
RVASPVTLRSLFDADPDLTKEGGGAYLAELAGNIVTVVNAADYGRTIHDLFMRRQLIEVT
AEAMEEAYRPSLTRPEEMIANLDASTAALLVHAHAGAAELVTAADAAEGAMQAAQRAQHA
PDGVSGLATGLVDLDRRLGGLQGGDLVIIAGRPSMGKTVLGMTIATNAADRGEPGLFNSL
EMGTVSLGQRLLASRSGISVQDQRGPLSPEQFRALVDAQQHFANMPLRIDPQAGLTAAQI
AARARLHQRKHGLKLLLIDYLGLVAPADPRANKVHQVEAITTALKLLAKELDTPVILLAQ
LSRQVEQREDKRPQLADLRDSGAIEQDADVVMLLFREQYYLERAEPTRRANEGQDAYNAR
YGEWVQRLEECQGIGEIIIAKNRQGGTGTVAVRFDGQRQTFENLHRGGRP