Protein Info for MPMX19_02327 in Azospirillum sp. SherDot2

Annotation: Ribosomal RNA small subunit methyltransferase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF01029: NusB" amino acids 8 to 128 (121 residues), 79.8 bits, see alignment E=3.7e-26 PF01189: Methyltr_RsmB-F" amino acids 239 to 427 (189 residues), 160.6 bits, see alignment E=5.9e-51 PF13649: Methyltransf_25" amino acids 241 to 307 (67 residues), 27.9 bits, see alignment E=4.9e-10

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 97% identity to azl:AZL_002370)

Predicted SEED Role

"16S rRNA m(5)C 967 methyltransferase (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>MPMX19_02327 Ribosomal RNA small subunit methyltransferase B (Azospirillum sp. SherDot2)
MTDTSLAARGVALDLLRDVLRKSVPFDDAFDAHPELAALQPRDRGFVRLLVATVLRRLGQ
IDEMIQASLAKPGLPKAAIHDMLRLGTAQLVFLNTPAHAAVDTAVELAAARNAAPYKGLI
NAVLRRIGREGAEMAARQDAGRLNTPDWLWLSWRSAYGTARTRGIVEAHLHEAPLDITVK
SDPAGWAERLGATLLPTGSLRRPTGGSVTELPGFEDGEWWIQDLAASLPAKLFGDLAGKR
VFDLCAAPGGKTAQLVVRGAQVTAIDRSARRLERVTENLKRLRLEADVLAADATTWEPEE
PADAVLLDAPCSATGAIRRHPDILRVKTPDDIAKLARAQSRLLARSVELVKPGGTLIYCT
CSIQPEEGEVQVARLLEQDKRVERWPVTADELGGLSEPINEAGEVRSLPGMLADLGGIDG
FFVARLRRRQG