Protein Info for MPMX19_02244 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 53 to 78 (26 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details PF09335: SNARE_assoc" amino acids 51 to 157 (107 residues), 44.5 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: None (inferred from 98% identity to azl:AZL_002820)

Predicted SEED Role

"FIG139438: lipoprotein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>MPMX19_02244 hypothetical protein (Azospirillum sp. SherDot2)
MLKRLYDWTMAKAASKDSTAWLAGVSFAESSFFPLPPDLLLVPMVIANRKAAWKLATICT
LASVVGGIAGYMIGYFLYETIGRWVIEFYHLTDKFEQLRHTFVEYGAEILIIKGMTPIPY
KLLTITAGVAHLPLWVFIGASIISRSIRFYLVAALLYFFGPPIRAFIEKRLTLVTSVFAV
ALIGGFLVVKLL