Protein Info for MPMX19_02108 in Azospirillum sp. SherDot2
Annotation: Transaldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 76% identical to TAL_RHOCS: Probable transaldolase (tal) from Rhodospirillum centenum (strain ATCC 51521 / SW)
KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 99% identity to azl:AZL_024980)Predicted SEED Role
"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)
MetaCyc Pathways
- Rubisco shunt (10/10 steps found)
- superpathway of glucose and xylose degradation (15/17 steps found)
- Bifidobacterium shunt (13/15 steps found)
- pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- pentose phosphate pathway (7/8 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Pentose phosphate pathway
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.2.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (218 amino acids)
>MPMX19_02108 Transaldolase (Azospirillum sp. SherDot2) MKFFVDTADIAEIRDLADTGLLDGVTTNPSLIAKSGRQFLDLVAEICDVVNGPVSAEVAS TDFETMLAEAHKIAKISHRVAVKVPLTPAGLKVCKIISSEGTMVNVTLCFSPAQAILAAK AGASFVSPFVGRLDDIGQDGMGIIKDICEIYNNYDAFKTEVLVASIRNPMHIVKAARLGA HVVTAPASVLKQLFNHPLTDKGLSQFVEDWKKTGQSIL