Protein Info for MPMX19_02018 in Azospirillum sp. SherDot2

Annotation: 2-hydroxy-3-oxopropionate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF02826: 2-Hacid_dh_C" amino acids 7 to 117 (111 residues), 36.9 bits, see alignment E=6.4e-13 PF07991: IlvN" amino acids 10 to 99 (90 residues), 22.3 bits, see alignment E=2.2e-08 PF03446: NAD_binding_2" amino acids 14 to 170 (157 residues), 154.9 bits, see alignment E=4.8e-49 PF03807: F420_oxidored" amino acids 14 to 102 (89 residues), 43.5 bits, see alignment E=1e-14 PF14833: NAD_binding_11" amino acids 173 to 292 (120 residues), 108.3 bits, see alignment E=7.4e-35

Best Hits

KEGG orthology group: None (inferred from 91% identity to azl:AZL_024200)

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.60

Use Curated BLAST to search for 1.1.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>MPMX19_02018 2-hydroxy-3-oxopropionate reductase (Azospirillum sp. SherDot2)
MTEETIRPDLAGQRVGVIGLGLMGKPMARALARAGAELVVASRSPGPVAELAAEGMIAAT
GPAAVAGQAGIVILMLTDTNAVETVAEALLPVLRPGHLVIDMGTTAVAATRALAQRVAAA
GAEWLDAPVSGGTVAAEGAILTIMAGGSEAAFARALPVLQAMGRRITHVGDSGAGQIAKS
ANQVIVALTIGAVAEALALARAAGADPAKVRDAIRGGFAESRILDLHGGRMVSGDFTPGG
RVTTQVKDLKQAEELAQQSGIDLPTLGLSLELFEMLVDQGDGALDHSALYRLFAR