Protein Info for MPMX19_01989 in Azospirillum sp. SherDot2

Annotation: Putative peroxiredoxin bcp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00578: AhpC-TSA" amino acids 5 to 133 (129 residues), 142.2 bits, see alignment E=8.4e-46 PF08534: Redoxin" amino acids 5 to 136 (132 residues), 74.9 bits, see alignment E=6e-25

Best Hits

Swiss-Prot: 59% identical to BCP_COXBU: Putative peroxiredoxin bcp (bcp) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K03564, peroxiredoxin Q/BCP [EC: 1.11.1.15] (inferred from 97% identity to azl:AZL_023810)

MetaCyc: 43% identical to thiol peroxidase (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Thiol peroxidase, Bcp-type (EC 1.11.1.15)" in subsystem Thioredoxin-disulfide reductase (EC 1.11.1.15)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>MPMX19_01989 Putative peroxiredoxin bcp (Azospirillum sp. SherDot2)
MTVDVGSPAPDFTMPTDGGGSVTLSALRGKPVILYFYPKDDTSGCTSEACGFRDQLPDFS
AVDAVVIGVSKDSVASHDKFKAKHELTFTLASDTDSAVCEAYGTWVEKSMYGRKYMGIDR
ATFLIDKDGVVRNVWRKVKVTGHVAAVLKAVQAL