Protein Info for MPMX19_01986 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 80 to 123 (44 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 185 to 212 (28 residues), see Phobius details amino acids 221 to 243 (23 residues), see Phobius details amino acids 397 to 417 (21 residues), see Phobius details amino acids 429 to 451 (23 residues), see Phobius details amino acids 457 to 474 (18 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 82% identity to azl:AZL_023780)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (528 amino acids)

>MPMX19_01986 hypothetical protein (Azospirillum sp. SherDot2)
MRFWNASRISPAPIAVLTIILAGVLIGAPLLVLNGFPLTFDDTPGYLEPAFNILHRAAQP
AWTPPPDLSPHGLPSPNIFFLRPFGYMLFLLPFAGGWGVWLVPLAQGILAAAVLRAALTA
AGVPERPGLFLGIAAVLGLTTSLSLHAATIMPDFLTGLAILLVYVVVVRWPALTAVQRLL
TVAALTGTIVSHLSHLAILGGMIVLLGLWALWHDRALLRSLAWGVLLPMVLAVGLLTGSN
LLTAGRPVLSESSPVFLLARLIGDGPARDYLAEACPSRDYLLCGSLDRLDRSAPGYVTSD
YFLWHPDGARRRFGDQPRFVTEAAEIAHNTIASRPAAVATHGLTNAIGQFVEVQPDDTLN
DPVKPLTRRLFSRFPAPVYAAFDRSLQTQQRFPRDGLALVQDLSLSLGVLGMAALGLGRW
RRVDGRVRMLILVIGLGLTLNAVVTGGLSAVHDRYQNRVIWLVPFAALVLLATARSRDAS
RDVLPAGQTGRTGSGQPAGWNTPPGMGTGTPVVAGRLSGSPSLLRTAR