Protein Info for MPMX19_01873 in Azospirillum sp. SherDot2

Annotation: Glycine--tRNA ligase alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR00388: glycine--tRNA ligase, alpha subunit" amino acids 20 to 295 (276 residues), 479.8 bits, see alignment E=1.5e-148 PF02091: tRNA-synt_2e" amino acids 21 to 295 (275 residues), 498.4 bits, see alignment E=2.7e-154

Best Hits

Swiss-Prot: 81% identical to SYGA_RHORT: Glycine--tRNA ligase alpha subunit (glyQ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01878, glycyl-tRNA synthetase alpha chain [EC: 6.1.1.14] (inferred from 97% identity to azl:AZL_022760)

MetaCyc: 64% identical to glycine--tRNA ligase subunit alpha (Escherichia coli K-12 substr. MG1655)
Glycine--tRNA ligase. [EC: 6.1.1.14]

Predicted SEED Role

"Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)" (EC 6.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.14

Use Curated BLAST to search for 6.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>MPMX19_01873 Glycine--tRNA ligase alpha subunit (Azospirillum sp. SherDot2)
MASQIGTSDGGNSADRRGLSFQALILKLHQFWSEQGCVILQPYDMEVGAGTFHPATTLRA
LGPESWKAAYVQPSRRPKDGRYGENPNRLQHYYQYQVIMKPSPANAQELYLDSLRAIGID
PALHDIRFVEDDWESPTLGAWGLGWEVWCDGMEVTQYTYFQQVGGIECDPVAVELTYGLE
RLAMYVQGVENVYDLDFNGQGVKYGDVFKRAEIEYSKHNFEFANTDMLLQHFKDAEAECQ
ALVAQNLALPAYDQCIKASHLFNLLDARGVISVVERAAYIGRVRTLAKACCEAWTGAK