Protein Info for MPMX19_01770 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 66 to 94 (29 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details PF04093: MreD" amino acids 15 to 151 (137 residues), 55 bits, see alignment E=5.3e-19 TIGR03426: rod shape-determining protein MreD" amino acids 16 to 156 (141 residues), 60.1 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 94% identity to azl:AZL_021660)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>MPMX19_01770 hypothetical protein (Azospirillum sp. SherDot2)
MTATFWQKVDKTGRNLAPFAVTVMMVLVGMIPLPVPGYAPVAPNLTLVSVYYWTIHRPDL
MRPGVAFLIGLLQDFLIGGPLGVNALLLVVAQWAVLNQRRVFLASTFALLWVGFTLVMAG
AVLLQWLAFSVLDAVTLSILPALFQGLLTVAVFPAVGWLLIRVHRAFLNG