Protein Info for MPMX19_01760 in Azospirillum sp. SherDot2

Annotation: Oligoendopeptidase F, plasmid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 TIGR02290: oligoendopeptidase, pepF/M3 family" amino acids 20 to 598 (579 residues), 654 bits, see alignment E=1.5e-200 PF08439: Peptidase_M3_N" amino acids 123 to 192 (70 residues), 73 bits, see alignment E=1.8e-24 PF01432: Peptidase_M3" amino acids 209 to 588 (380 residues), 140.3 bits, see alignment E=1.3e-44

Best Hits

KEGG orthology group: K08602, oligoendopeptidase F [EC: 3.4.24.-] (inferred from 95% identity to azl:AZL_021580)

Predicted SEED Role

"Oligoendopeptidase F (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (604 amino acids)

>MPMX19_01760 Oligoendopeptidase F, plasmid (Azospirillum sp. SherDot2)
MTSSAAMAANDTPDLGALPTWDLSDLYPGTESPELKADLDRMERECKAFRERYAGKLAAL
SGDDLAAAIRQYEDIDETLSRVMSYAGLVYNGNMVDPIVAKFYQSAQERVNDISAHLIFF
TLEINRLDENDLAAKQKASPSLRHYEPWLRDVRLYRDHQLSDEIERLLHEKHVVGRAAWN
RLFDETIASLRFPMGGKELTCAEALNRLSDRNPAVRREAGEVVGKVLGENARLFALVTNT
LAKDKEIEDEWRNYPTPTSARNLSNRVEDEVVDALVSAVKGAYPDLSHRYYTMKAKWFGQ
DHLDYWDRNAPLPEDADRSIPWNEARDIVLGAYGRFSPDLASLGKRFFDNPWIDAPVRPG
KAPGAFAHPTVPSVHPYLLVNYQGKTRDVMTLAHELGHGVHQILAGKQGHFLSDTPLTLA
ETASVFGEMLTFRALLAAETDPKRRRIMLAGKVEDMLNTVVRQIAFFDFERRVHTERREG
ELTSDRIGEIWMAVQTESLGPALRFDEGYRHFWSYIPHFIHSPFYVYAYAFGDCLVNSLY
AVYQDAEQGFAEKYLAMLSAGGTLRHKELLAPFGLDASDPAFWQKGLGVIRGFIDELEAS
EAKA