Protein Info for MPMX19_01723 in Azospirillum sp. SherDot2

Annotation: Lipoprotein-releasing system transmembrane protein LolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 22 to 49 (28 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 316 to 342 (27 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 6 to 415 (410 residues), 498.2 bits, see alignment E=9.2e-154 PF12704: MacB_PCD" amino acids 31 to 244 (214 residues), 68.1 bits, see alignment E=1.3e-22 PF02687: FtsX" amino acids 275 to 408 (134 residues), 63.7 bits, see alignment E=1.6e-21

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 97% identity to azl:AZL_021220)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>MPMX19_01723 Lipoprotein-releasing system transmembrane protein LolC (Azospirillum sp. SherDot2)
MIFNAFERMVAMRYLRARRQEGFISVIAGFSLLGIALGVATLIIVMAVMNGFRAELLGRV
LGLNGHLNVYSSRGGPLPDFDILAGKLRNTPGVVNVTPTVEGQALVSVRGVASGAVIRGV
RAEDFKVRPTLANNVIRGSVDEFGEDRVAIGVRMAQRLGLSVGDQITLIAPQGNVTAFGT
VPRMRSYPIGAIFDVGMFEYDNSFIFLPLEEAQAFFRTGDAVTSLEVFVSDPMQIAAARS
AVQSAVAGEGRVVDWQQSNASFFTALQVERNVMFLILSLIIMVAAFNIISSLIMLVKDKG
RDIAILRTMGATRGMIMRIFFLSGASVGVTGTLLGLALGVSFALNIESIRQVIQGLTGTN
LFNAEIYFLSHLPAKIDWSEVTQVTLMALGLSFAATIYPSWRAARLDPVEALRYE