Protein Info for MPMX19_01719 in Azospirillum sp. SherDot2

Annotation: Putative fluoride ion transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details PF02537: CRCB" amino acids 9 to 122 (114 residues), 87.4 bits, see alignment E=3.8e-29 TIGR00494: protein CrcB" amino acids 9 to 123 (115 residues), 81.7 bits, see alignment E=2.7e-27

Best Hits

Swiss-Prot: 56% identical to CRCB_RHOCS: Putative fluoride ion transporter CrcB (crcB) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K06199, CrcB protein (inferred from 94% identity to azl:AZL_021180)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>MPMX19_01719 Putative fluoride ion transporter CrcB (Azospirillum sp. SherDot2)
MLASPLSLLAVAVGGAAGSVARYLMLLVIAQWIGSRFPVGTIIVNVIGCTVMGVLSELAA
LTWSPSPELRAFLLVGILGGFTTFSSFTLDIGVLVARDEIAAAAGYFLASTLFSVVGFFA
GLWAVRSLVSVSL