Protein Info for MPMX19_01717 in Azospirillum sp. SherDot2

Annotation: Pyrophosphatase PpaX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00702: Hydrolase" amino acids 16 to 192 (177 residues), 90 bits, see alignment E=5.5e-29 PF12710: HAD" amino acids 18 to 190 (173 residues), 57.4 bits, see alignment E=5.6e-19 PF13419: HAD_2" amino acids 19 to 199 (181 residues), 113.6 bits, see alignment E=2.5e-36 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 97 to 192 (96 residues), 39.2 bits, see alignment E=8.9e-14 PF13242: Hydrolase_like" amino acids 155 to 218 (64 residues), 47.3 bits, see alignment E=3.1e-16

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 92% identity to azl:AZL_021160)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>MPMX19_01717 Pyrophosphatase PpaX (Azospirillum sp. SherDot2)
MMAPLVTAALGKSPLRLALFDCDGTLVDSQFAIIDAMTRAWAEHGLGEPEPADVRRMVGL
SLVEAVALLLPQRDADLHVAVAESYKRAFSNARSRGEVDEPLFPGILDTLAALEEAGVLL
GVATGKSRRGLDAVLKGHGLTGRFVTLQTADIGPGKPNPHMVQRALAETGAEEAATVVIG
DTTYDIQMARNARVRSVGVSWGYHAVPELERAGADRIVHRGRDVATAVLELLEG