Protein Info for MPMX19_01707 in Azospirillum sp. SherDot2

Annotation: Phosphatidylserine decarboxylase proenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 11 to 219 (209 residues), 177.9 bits, E=8.2e-57
• PF02666: PS_Dcarbxylase
  • amino acids 45 to 217 (173 residues), 145.1 bits, E=1.1e-46

Best Hits

Swiss-Prot: 65% identical to PSD_MAGSA: Phosphatidylserine decarboxylase proenzyme (psd) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 97% identity to azl:AZL_021070)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (9/12 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (2/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (7/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Protein Sequence (232 amino acids)

>MPMX19_01707 Phosphatidylserine decarboxylase proenzyme (Azospirillum sp. SherDot2)
MSAIDTVVVPIHRAGWPFIAGFAVVSLILGLAVWAPLGWIGLVLTLWCAYFFRDPDRVTP
TRPGLLVSPADGRVTMIVQAVPPKELGMGDKALTRISVFLNVFNVHVNRVPADGTIVAAE
YHKGTFVNAALDKASDENERMAFRHRLPDGREIAYVQIAGLVARRILWWVKAGQQVKAGE
RFGLIRFGSRTDIYLPDGVAPLVCVGQTAIGGETILADLDGTETQRQGDVRR