Protein Info for MPMX19_01698 in Azospirillum sp. SherDot2

Annotation: NADPH-dependent 7-cyano-7-deazaguanine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03139: 7-cyano-7-deazaguanine reductase
  • amino acids 23 to 133 (111 residues), 146 bits, E=2e-47
• PF14489: QueF
  • amino acids 58 to 136 (79 residues), 106 bits, E=4.7e-35

Best Hits

Swiss-Prot: 82% identical to QUEF_BRUSI: NADPH-dependent 7-cyano-7-deazaguanine reductase (queF) from Brucella suis (strain ATCC 23445 / NCTC 10510)

KEGG orthology group: K09457, 7-cyano-7-deazaguanine reductase [EC: 1.7.1.13] (inferred from 98% identity to azl:AZL_020990)

Predicted SEED Role

"NADPH dependent preQ0 reductase (EC 1.7.1.13)" (EC 1.7.1.13)

MetaCyc Pathways

• queuosine biosynthesis I (de novo) (3/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.13

Protein Sequence (154 amino acids)

>MPMX19_01698 NADPH-dependent 7-cyano-7-deazaguanine reductase (Azospirillum sp. SherDot2)
MSENIYAGLTQLGGSTIQPRTPEEAVLERVPNPSPGTPYCVRFTAPEFTSLCPITGQPDF
AHLVIDYVPGDWLVESKSLKLFLTSFRNHGAFHEACTVGIGKRLVDELSPVWLRIGGYWY
PRGGIPIDVFFQTGEPPKGVWIPSQDVPTYRGRG