Protein Info for MPMX19_01670 in Azospirillum sp. SherDot2

Annotation: Ribosomal RNA small subunit methyltransferase H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR00006: 16S rRNA (cytosine(1402)-N(4))-methyltransferase" amino acids 6 to 311 (306 residues), 319.9 bits, see alignment E=9.8e-100 PF01795: Methyltransf_5" amino acids 7 to 311 (305 residues), 342.8 bits, see alignment E=2.2e-106

Best Hits

Swiss-Prot: 71% identical to RSMH_RHOCS: Ribosomal RNA small subunit methyltransferase H (rsmH) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K03438, S-adenosyl-methyltransferase [EC: 2.1.1.-] (inferred from 94% identity to azl:AZL_020740)

Predicted SEED Role

"rRNA small subunit methyltransferase H" in subsystem Bacterial Cell Division

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>MPMX19_01670 Ribosomal RNA small subunit methyltransferase H (Azospirillum sp. SherDot2)
MTTGTRIHIPVLLDEVIAALSPRDGGLYVDGTFGAGGYSRALLQSASCRVIGIDRDPAAI
ERGRALAQEFPGRLEVIEGRFGDMDRLLADHGVGTVDGVALDVGVSSPQIDEPERGFSFR
FDGPLDMRMGRDGPTAADVVNTADESDLADIVYHLGEERMARRVARAIVAARREAPIERT
GRLAEIIRSVVPKGKGDGIDPATRTFQALRIHVNDELGELRRGLSAAESLLAPGGRLAVV
SFHSLEDREVKAFLRERSSPPPSPSRHTPVTAVAAHHPSFRLLSRKPVDPSEAEARNNPR
ARSARLRAAERTEAPAFPASGKEAA