Protein Info for MPMX19_01658 in Azospirillum sp. SherDot2

Annotation: tRNA-specific 2-thiouridylase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF00733: Asn_synthase" amino acids 11 to 87 (77 residues), 24 bits, see alignment E=5.7e-09 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 14 to 373 (360 residues), 326.8 bits, see alignment E=7e-102 PF03054: tRNA_Me_trans" amino acids 14 to 211 (198 residues), 249.4 bits, see alignment E=5.4e-78 PF20259: tRNA_Me_trans_M" amino acids 227 to 285 (59 residues), 62.2 bits, see alignment E=5.3e-21 PF20258: tRNA_Me_trans_C" amino acids 295 to 373 (79 residues), 66.8 bits, see alignment E=3.6e-22

Best Hits

Swiss-Prot: 74% identical to MNMA_RHOCS: tRNA-specific 2-thiouridylase MnmA (mnmA) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 95% identity to azl:AZL_020120)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>MPMX19_01658 tRNA-specific 2-thiouridylase MnmA (Azospirillum sp. SherDot2)
MNSLGLSKRPQDTRVVVAMSGGVDSSVTAAVLREEGYDVVGITLQLYDHGLALQKPGACC
AGQDIYDARQVADRIGIPHYVLDYEGRFSQDVMDDFADSYLRGETPIPCVRCNQRVKFRD
LLNTARDLGAEALATGHYVRRIAGPHGAELHRAVDPAKDQSYFLFATTREQLEFLRFPLG
GLTKPETRALAERHGLEVAAKPDSQDICFVPNGNYAEVVAKLRPGSVEPGDIVHVDGRVL
GRHKGVVHYTVGQRKGLGIGGIRGQEEEALYVVRLEPARRRVVVGPRRDLARSLVTVRDV
NWLGPDPAPDMADGAGIEVSVKLRSTQPAAPALWRAGPDGTARVELLEPQHGIAPGQACV
VYQGDRVLGGGWISATAGGVGEDAAKLVGAGETAA