Protein Info for MPMX19_01533 in Azospirillum sp. SherDot2

Annotation: DNA-directed RNA polymerase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 TIGR02027: DNA-directed RNA polymerase, alpha subunit" amino acids 27 to 318 (292 residues), 381.2 bits, see alignment E=1.6e-118 PF01193: RNA_pol_L" amino acids 32 to 227 (196 residues), 89.2 bits, see alignment E=1.7e-29 PF01000: RNA_pol_A_bac" amino acids 62 to 177 (116 residues), 118.6 bits, see alignment E=2.7e-38 PF03118: RNA_pol_A_CTD" amino acids 249 to 309 (61 residues), 90.3 bits, see alignment E=7.6e-30

Best Hits

Swiss-Prot: 85% identical to RPOA_MAGSA: DNA-directed RNA polymerase subunit alpha (rpoA) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03040, DNA-directed RNA polymerase subunit alpha [EC: 2.7.7.6] (inferred from 99% identity to azl:AZL_018760)

MetaCyc: 50% identical to RNA polymerase subunit alpha (Escherichia coli K-12 substr. MG1655)
DNA-directed RNA polymerase. [EC: 2.7.7.6]

Predicted SEED Role

"DNA-directed RNA polymerase alpha subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>MPMX19_01533 DNA-directed RNA polymerase subunit alpha (Azospirillum sp. SherDot2)
MLQKNWQELIKPSKLDIQPGDDADRFATVVAEPLERGFGLTLGNALRRILLSSLQGAAVT
SIHIDGVLHEFSSIPGVREDVTDIVLNIKTMGLRMGGDGPKRMRLRAEGPGEVKAGMIET
GPDIQVMDPELIICTLDNGARLNMELTVETGKGYVPASQNRPEDAPIGLIPIDALFSPVR
KVSYKVDNARVGQVTDYDRLSMTVETNGSVKPDDAVALAARILQDQLQLFINFEEPTHAV
SEEKHEEVPFNKNLLRKVDELELSVRSANCLKNDNIVYIGDLVQKTEAEMLRTPNFGRKS
LNEIKEVLSQMGLHLGMEIPNWPPENIEELAKRLEEPY