Protein Info for MPMX19_01525 in Azospirillum sp. SherDot2

Annotation: Glycerate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 46% identical to GYAR_THELN: Glyoxylate reductase (gyaR) from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

KEGG orthology group: None (inferred from 89% identity to azl:AZL_018710)

MetaCyc: 44% identical to glyoxylate reductase (Pyrococcus furiosus DSM 3638)
Glyoxylate reductase. [EC: 1.1.1.26]

Predicted SEED Role

"D-3-phosphoglycerate dehydrogenase (EC 1.1.1.95)" in subsystem Glycine and Serine Utilization or Pyridoxin (Vitamin B6) Biosynthesis or Serine Biosynthesis (EC 1.1.1.95)

MetaCyc Pathways

superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
L-serine biosynthesis I (3/3 steps found)
L-cysteine biosynthesis IX (Trichomonas vaginalis) (2/3 steps found)
D-xylose degradation IV (3/7 steps found)
L-arabinose degradation IV (3/8 steps found)
superpathway of pentose and pentitol degradation (14/42 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.26, 1.1.1.95

Use Curated BLAST to search for 1.1.1.26 or 1.1.1.95

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>MPMX19_01525 Glycerate dehydrogenase (Azospirillum sp. SherDot2)
MTQSDSPASDSSARPVLLLTRRLPDAVEARASCDYRAVLNPEDRAFSGQEIAARAAEVGA
DAVLCCAGDRLDAAAIAALPRSVRVLATFSVGTDHIDLEAARARGLTVTNTPDVLTDATA
DIALLLLLGAARRASEGERMIRANAWTGWTPTQLMGTHVGAKRLGIVGMGRIGQAVAARA
RAFGMTIHYSNRRRLAPELELGATYHADPEAMLPVCDVLSLHFPATAETRHWLNADRIER
LPPGAILINTARGSVVDDGAVIDALKRGRLAAAGLDVFENEPNLHPGYRNLPNTFLLPHL
GSATVETRNAMGFKALDNVDAVTAGRPAPDRVV