Protein Info for MPMX19_01446 in Azospirillum sp. SherDot2

Annotation: Secretory immunoglobulin A-binding protein EsiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF08238: Sel1" amino acids 25 to 55 (31 residues), 13.9 bits, see alignment 3.5e-06 amino acids 57 to 91 (35 residues), 39.1 bits, see alignment 3.9e-14 amino acids 94 to 125 (32 residues), 35.8 bits, see alignment 4.2e-13 amino acids 128 to 163 (36 residues), 38.1 bits, see alignment 7.8e-14 amino acids 164 to 199 (36 residues), 34.5 bits, see alignment 1.1e-12

Best Hits

Predicted SEED Role

"TETRATRICOPEPTIDE REPEAT FAMILY PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>MPMX19_01446 Secretory immunoglobulin A-binding protein EsiB (Azospirillum sp. SherDot2)
MSMLAKPMLATPTLWTRMKAELGDSDAQYRLAEAVRTADVAASVSWYRRAARQGHVAAQT
MLAFLLANGIGVPPDPRRAVSWYRRAAAKGDVGAQNNLGYMHEHGAGVPCDPAKAALWYR
LAALQHSAPAQVNLALLLLDGRGVDRDETEAVRWLRAAAEQGHPAAQYRLGLCLREGVGA
TRDPAEAALWLQAAAAAGDRDALVALAELRQTVLPDLRPDLSLDWPDAAEDEDDAAPWRP
EQRRMQEIPMQNAHAGAMPPG