Protein Info for MPMX19_01414 in Azospirillum sp. SherDot2

Annotation: ATP-dependent 6-phosphofructokinase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00365: PFK" amino acids 10 to 314 (305 residues), 337.4 bits, see alignment E=3.3e-105

Best Hits

Swiss-Prot: 68% identical to PFKA1_SYNY3: ATP-dependent 6-phosphofructokinase 1 (pfkA1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 99% identity to azl:AZL_017430)

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11)" in subsystem D-Tagatose and Galactitol Utilization or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>MPMX19_01414 ATP-dependent 6-phosphofructokinase 2 (Azospirillum sp. SherDot2)
MTAPNKAGKRIGILTSGGDCAGLNAVIRAVVHRATGYGWQVLGIKEGTQGLLQRPVQYQT
LDLGSVDGHMMRQGGTILGTTNRGDPFAYPMPDGTLKDRSDEIVGGYRELGLDALIGIGG
DGSFAILHKLAQKGGFPMVGVPKTIDNDLGKTEVSVGYDTAVAVAVEALDRLQPTAASHH
RVMVLEVMGRDAGHIALAAGIAGGADVILIPEIPYSIESIAAKIQSVRDSGRNFALVVVS
EAVKTLEGTGVKKILQGGEKRYGGIGDYIGEKIADATGAETRVTVLGHVQRGSMPSPRDR
LIASAFGVHAVDLIAEGKFNRMVAWSNRGVIDVPITEAIEHYSCVELDGALVKTARGLNI
SFGD