Protein Info for MPMX19_01399 in Azospirillum sp. SherDot2

Annotation: Pyrroline-5-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00112: pyrroline-5-carboxylate reductase" amino acids 10 to 272 (263 residues), 240.4 bits, see alignment E=1.4e-75 PF03807: F420_oxidored" amino acids 11 to 102 (92 residues), 33.8 bits, see alignment E=4.4e-12 PF14748: P5CR_dimer" amino acids 166 to 272 (107 residues), 109.2 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K00286, pyrroline-5-carboxylate reductase [EC: 1.5.1.2] (inferred from 92% identity to azl:AZL_017290)

Predicted SEED Role

"Pyrroline-5-carboxylate reductase (EC 1.5.1.2)" in subsystem Proline Synthesis (EC 1.5.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>MPMX19_01399 Pyrroline-5-carboxylate reductase (Azospirillum sp. SherDot2)
MTAESGASLLLVGCGKMGGAMLDGWLAAGTASRVVVVDRAGLPQSVAGDARVTLASGADA
LPDGLVPDVVVLAVKPQVMEEALPSYRALVGPDTVFLSIAAGKTIAYFERLLGEGTVVVR
SMPNTPAAIGRGMTVAVANSRVSADQRDLSDRLLRAVGDVAWVEDEGLLDPVTAVSGSGP
AYVFFLVEAMAKAGEAAGLPADLAMRLARATVSGAGALLDASPQQEAADLRKAVTSPNGT
TQAALEVLMAPEGVQPVMTTAIAAATRRSRELAG