Protein Info for MPMX19_01386 in Azospirillum sp. SherDot2

Annotation: Iron deficiency-induced protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01547: SBP_bac_1" amino acids 38 to 285 (248 residues), 68 bits, see alignment E=2.9e-22 PF13531: SBP_bac_11" amino acids 39 to 289 (251 residues), 63.2 bits, see alignment E=6.5e-21 PF13416: SBP_bac_8" amino acids 40 to 309 (270 residues), 87 bits, see alignment E=3.9e-28 PF13343: SBP_bac_6" amino acids 73 to 303 (231 residues), 88.6 bits, see alignment E=9.2e-29

Best Hits

Swiss-Prot: 56% identical to IDIA_SYNE7: Iron deficiency-induced protein A (idiA) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 91% identity to azl:AZL_012430)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>MPMX19_01386 Iron deficiency-induced protein A (Azospirillum sp. SherDot2)
MFIDKIAGVAFAVGALTAFSVQAQEVNVYNSRHYNTDRAIYETFTKSTGIKVNIIEGNHD
ELIQRMKSEGASSPADLFITVDAGRLAAAAQEGLLASVTSPQLDAVKVPANLRDPNGAWW
GLSSRARIVVYARDRVKPEQIKDYEDLAKPEWKHRVLTRSGTHPYSLALTASMIEALGEE
KTEEWVKGLVANLARPPQGGDIDQIKAVAVGEGDLAIANTYYVGKMITSAKQEDREVASR
IGVIFPNQGNRGTHVNLSGAGVVKTSKNQDNARKLLEYLLSPEAQRQFADGNMEYPVNPA
VQPHPELVKLGSFKAAEVNAASFAAHTPQALRIMDRAGWK