Protein Info for MPMX19_01270 in Azospirillum sp. SherDot2

Annotation: L-threonine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF00291: PALP" amino acids 17 to 302 (286 residues), 253.7 bits, see alignment E=3.7e-79 TIGR01127: threonine ammonia-lyase" amino acids 28 to 396 (369 residues), 412.6 bits, see alignment E=7.5e-128 PF13291: ACT_4" amino acids 325 to 391 (67 residues), 28.8 bits, see alignment E=2.3e-10 PF01842: ACT" amino acids 326 to 391 (66 residues), 28.6 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 95% identity to azl:AZL_013420)

Predicted SEED Role

"Threonine dehydratase (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis or Threonine degradation (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>MPMX19_01270 L-threonine ammonia-lyase (Azospirillum sp. SherDot2)
MTITLEDVRAAAARIAGHLPRTPTVPAPRLGDMAGCRMHVKLENQHATSSFKERGALNKL
LSLGEAERRAGVIAMSAGNHAQAVACHATRLGIRSTIVMPAFTPFTKVERTENLGATVEL
HGETLSEAAAFAHELAARDGLTFVHPYDDPLVAAGQGTAALELLEDVPDLDVLVVPIGGG
GLISGMATAAKALRPDLEIVGVQCSLYPAVRQALAGQPITCGGATVAEGIAVKAPGALTL
PIIRALVDDVVEVGEARLEEAVYRLATVQKLVAEGAGAAALAAVLEDPQRYRGRKVGIVL
SGGNIDSRIMAQVLMRGLVYEGRIVRLRIGITDAPGALARVTRLLGEAGANIVEVHHQRL
FHNVPVKMAEVDVVLETRNQTHVDALIARMKDAGYPTSLMMEVG