Protein Info for MPMX19_01252 in Azospirillum sp. SherDot2

Annotation: Iron-sulfur cluster carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF01883: FeS_assembly_P" amino acids 6 to 76 (71 residues), 68.3 bits, see alignment E=1.8e-22 PF10609: ParA" amino acids 129 to 371 (243 residues), 357.3 bits, see alignment E=1.4e-110 PF13614: AAA_31" amino acids 132 to 169 (38 residues), 35.8 bits, see alignment 2.9e-12 PF09140: MipZ" amino acids 132 to 259 (128 residues), 33.3 bits, see alignment E=1.1e-11 PF01656: CbiA" amino acids 133 to 299 (167 residues), 48.7 bits, see alignment E=2.6e-16 PF02374: ArsA_ATPase" amino acids 135 to 168 (34 residues), 22.7 bits, see alignment 1.9e-08

Best Hits

KEGG orthology group: K03593, ATP-binding protein involved in chromosome partitioning (inferred from 95% identity to azl:AZL_013580)

Predicted SEED Role

"Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>MPMX19_01252 Iron-sulfur cluster carrier protein (Azospirillum sp. SherDot2)
MAQISEAQVMQALKTVIDPDRGGDIVSLGMLSGLVVRDGHVAFSIEVDPKRGAQAEPLRH
AAEKAVDALPGVLSVTAVLTAHRAAPQGAAQSHTHSHGGQHGHSHGHSHGGAPQGAPQGD
PQKPLVPGVKAIVAVASGKGGVGKSTTSANLALALAANGLKVGLLDADIYGPSMPRMMGI
AGRPNSPDGKRLEPMENFGVKVMSMGFLVAEDTPMIWRGPMVMSALQQMLRDVNWGTLDV
LVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDIALLDARKGLNMFRRVDVPVLGIIENM
SYFCCPNCGHRTDIFSHGGARKEADDLGMEFLGEIPLHLSIRETSDQGQPIVVSQPDSEH
AQAYRRIAMRLWEKIGGGTGGRAAPRIVVQ