Protein Info for MPMX19_01219 in Azospirillum sp. SherDot2

Annotation: 4-hydroxy-tetrahydrodipicolinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF00701: DHDPS" amino acids 2 to 285 (284 residues), 320.2 bits, see alignment E=4.4e-100 TIGR00674: 4-hydroxy-tetrahydrodipicolinate synthase" amino acids 4 to 285 (282 residues), 331.6 bits, see alignment E=1.5e-103

Best Hits

Swiss-Prot: 73% identical to DAPA_RHOCS: 4-hydroxy-tetrahydrodipicolinate synthase (dapA) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K01714, dihydrodipicolinate synthase [EC: 4.2.1.52] (inferred from 94% identity to azl:AZL_013950)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)" (EC 4.3.3.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.52, 4.3.3.7

Use Curated BLAST to search for 4.2.1.52 or 4.3.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>MPMX19_01219 4-hydroxy-tetrahydrodipicolinate synthase (Azospirillum sp. SherDot2)
MFHGSIVALLTPFKGGKVDEKAFQSFVEWQVAQGTHGLVPCGTTGESPTLSHEEHNRVVE
LCIEAAGGKVPVMAGTGSNSTDEAIALTRHAKQAGAQAALVVTPYYNKPSQEGLYQHFKA
IHDAADLPIFIYNIPGRSVVDMSVATMARLAKLPNIVGVKDATADLSRPSRLLQEVGSDF
IQLSGEDATALAFNAQGGVGCISVTANIAPALCSAMQTAWAKGDLKEAFRLRDVLSPVHD
SMFVETSPAPVKFAASLLGLGSDEVRLPLVPATETARTAVRGAMTKAGLLS