Protein Info for MPMX19_01172 in Azospirillum sp. SherDot2

Annotation: Inner membrane transport protein YnfM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 224 to 248 (25 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 291 to 306 (16 residues), see Phobius details amino acids 312 to 337 (26 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 246 (221 residues), 107.4 bits, see alignment E=3.8e-35

Best Hits

Swiss-Prot: 45% identical to YYBF_BACSU: Uncharacterized MFS-type transporter YybF (yybF) from Bacillus subtilis (strain 168)

KEGG orthology group: K08224, MFS transporter, YNFM family, putative membrane transport protein (inferred from 94% identity to azl:AZL_014460)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>MPMX19_01172 Inner membrane transport protein YnfM (Azospirillum sp. SherDot2)
MAEQDNESPAYLVSGTPAYRRASRILFVAGFSTFATLYCVQPLLPDFVREFGVTPAESSL
SLSLTTGILAVALLVAGAISDGIGRKPVMVAALLGAGILGIVGALIPGWHGFLAVRALEG
LALSGLPAVAMAYVSEEVDPKSAGVAMGLYIGGTAIGGMSGRVLTAVLTDLGSWRLAVGV
VGALAVAAAVTVWFALPPSRHFVRRAAGLPALVRAWRGLLTDPALLGLFSLGFLLMGGFV
TVFNYIGFRLSEPPFELRPAIVGAVFLVYSFGVVSSPLFGGWSGRFGSNRTLAAAVALMV
TGLALMEIDSLFVIAFGIALFTFAFFGAHSIVSAWIGRRAAMARGQASSIYLFCYYLGST
LAGTLGGLFWHGYGWTGVAAFVSLLLTVAVGVTVGLQRSR