Protein Info for MPMX19_01117 in Azospirillum sp. SherDot2

Annotation: GTPase HflX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF13167: GTP-bdg_N" amino acids 6 to 92 (87 residues), 98.2 bits, see alignment E=6.7e-32 TIGR03156: GTP-binding protein HflX" amino acids 6 to 346 (341 residues), 447.6 bits, see alignment E=1.4e-138 PF16360: GTP-bdg_M" amino acids 95 to 174 (80 residues), 104.8 bits, see alignment E=6e-34 PF01926: MMR_HSR1" amino acids 182 to 303 (122 residues), 72 bits, see alignment E=9.1e-24 PF19275: HflX_C" amino acids 316 to 402 (87 residues), 35.4 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 96% identity to azl:AZL_015000)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>MPMX19_01117 GTPase HflX (Azospirillum sp. SherDot2)
MRPPESRLEEAVGLAQAIQLDVVHAECAKVNRPQPSTLLGSGTVEHLAQVVEEAEATLVI
LDHALSPVQQRNLERSLKAKVIDRTGLILEIFGARARTREGMLQVELASLTYQKSRLVRS
WTHLERQRGGFGFLGGPGESQLELDRRLIGDRIIKIKKELEEVRRTRGLHRKARAKVPYP
VVALVGYTNAGKSTLFNRLANADVFAQNLLFATLDPTMRQVTLPSGRKVILSDTVGFISD
LPHGLVAAFRATLEEVDAADIILHVRDIAHIDSDAQKADVHEVLSDMGIDPEADDRVIEV
LNKIDALDEESRAAILVQTGRNPRAVAVSALSGEGIDNLDRLLDQRMNVNRQVVDLSVGL
DDGAALAWLYARGEVLDRRDDEEHAHLHVSIDPVDLARFEKRFQSDSQAEPQP