Protein Info for MPMX19_01105 in Azospirillum sp. SherDot2

Annotation: Persistence and stress-resistance toxin PasT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF10604: Polyketide_cyc2" amino acids 7 to 133 (127 residues), 30.2 bits, see alignment E=5.1e-11 PF03364: Polyketide_cyc" amino acids 10 to 135 (126 residues), 117.9 bits, see alignment E=3.5e-38

Best Hits

Swiss-Prot: 35% identical to RATA_VIBCH: Ribosome association toxin RatA (ratA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 93% identity to azl:AZL_015140)

Predicted SEED Role

"Putative oligoketide cyclase/lipid transport protein, similarity with yeast ubiquinone-binding protein YOL008W"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>MPMX19_01105 Persistence and stress-resistance toxin PasT (Azospirillum sp. SherDot2)
MPTHAEKKVLPYTPQQMYDLVADVEKYPEFLPWCLAARIRKREDNVMFADLIIGFKMVRE
RFTSRVELHEPDCRINVQYTDGPFQYLNNHWIFNEHPGGCCVDFFVDFEFRSKMLQKIMG
LLFNEAVRRMVQAFEMRAAQLYGPGRATQPA