Protein Info for MPMX19_01092 in Azospirillum sp. SherDot2

Annotation: Ribulose-phosphate 3-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01163: ribulose-phosphate 3-epimerase
  • amino acids 5 to 217 (213 residues), 296.4 bits, E=4.8e-93
• PF00834: Ribul_P_3_epim
  • amino acids 5 to 202 (198 residues), 284.2 bits, E=2.3e-89

Best Hits

Swiss-Prot: 64% identical to RPE_BACSU: Ribulose-phosphate 3-epimerase (rpe) from Bacillus subtilis (strain 168)

KEGG orthology group: K01783, ribulose-phosphate 3-epimerase [EC: 5.1.3.1] (inferred from 95% identity to azl:AZL_015270)

MetaCyc: 57% identical to ribulose-phosphate 3-epimerase (Escherichia coli K-12 substr. MG1655)
Ribulose-phosphate 3-epimerase. [EC: 5.1.3.1]

Predicted SEED Role

"Ribulose-phosphate 3-epimerase (EC 5.1.3.1)" in subsystem Calvin-Benson cycle or Conserved gene cluster associated with Met-tRNA formyltransferase or Pentose phosphate pathway or Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 5.1.3.1)

MetaCyc Pathways

• Rubisco shunt (10/10 steps found)
• superpathway of glucose and xylose degradation (15/17 steps found)
• Calvin-Benson-Bassham cycle (12/13 steps found)
• Bifidobacterium shunt (13/15 steps found)
• heterolactic fermentation (15/18 steps found)
• ethene biosynthesis V (engineered) (20/25 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• pentose phosphate pathway (7/8 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• oxygenic photosynthesis (13/17 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Pentose and glucuronate interconversions
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.1

Use Curated BLAST to search for 5.1.3.1

Protein Sequence (217 amino acids)

>MPMX19_01092 Ribulose-phosphate 3-epimerase (Azospirillum sp. SherDot2)
MRAVKISPSILSADFARLGEEVRAVDAAGADYIHIDVMDGHFVPNLTIGPGVVKALRPHT
AKIFDVHLMISPVDLFVPEFVKAGADIITVHPEAGPHLHRTIQLIKSLGKKAGVSLNPAT
PVDAIQHVLEDIDLVLVMTVNPGFGGQSFIKSQLPKIRDLRARIDALGKKIDLEVDGGIN
PETARLAIEAGADVLVAGTATFTGGPEQYAANIAALR