Protein Info for MPMX19_01074 in Azospirillum sp. SherDot2

Annotation: Molybdopterin molybdenumtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 PF03453: MoeA_N" amino acids 17 to 182 (166 residues), 152.9 bits, see alignment E=9e-49 TIGR00177: molybdenum cofactor synthesis domain" amino acids 192 to 328 (137 residues), 86.6 bits, see alignment E=8.3e-29 PF00994: MoCF_biosynth" amino acids 195 to 330 (136 residues), 101.5 bits, see alignment E=5.3e-33 PF03454: MoeA_C" amino acids 346 to 417 (72 residues), 61.6 bits, see alignment E=1e-20

Best Hits

Swiss-Prot: 45% identical to MOEA_SALTY: Molybdopterin molybdenumtransferase (moeA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 90% identity to azl:AZL_015450)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>MPMX19_01074 Molybdopterin molybdenumtransferase (Azospirillum sp. SherDot2)
MVQLDNDCFAFGGPMMALEPALALLAGRVGPVTATEAVPLSDALGRVLAADLVAPFNVPP
HDNAAVDGYAVFFDDLDADAPTTLPVTARVAAGQWLGRPAARGEAVRIFTGAPMPAGMDT
VFMQEDCRSAGTGRDATVTLPPGIRRGVNRRLAGEDVREGSVVLSAGRRLRPEDIALAAS
LGHAMLDVRCRLRVAVFSTGDELRQPGQALEPGAVYDANRFALIALLTRLGCAVTDLGIL
PDRFEAIRDALAEAATGHDALITSGGMSTGEEDHVKPAVEANGRLDFWRLAIKPGRPVAL
GRVLDAVFVGLPGNPVAVVVTFLRIARPILLTLMGASAETPRPIPVRAGFAQKKKPGRRE
FLRGSLVLGADGALEATKYPRDGAGVLSSLVESEGLIELPEDLARVEPGMIVDFLPFKEF
L