Protein Info for MPMX19_01070 in Azospirillum sp. SherDot2

Annotation: UvrABC system protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 TIGR00194: excinuclease ABC subunit C" amino acids 68 to 646 (579 residues), 544 bits, see alignment E=2.3e-167 PF01541: GIY-YIG" amino acids 78 to 152 (75 residues), 27.6 bits, see alignment E=5.8e-10 PF02151: UVR" amino acids 273 to 295 (23 residues), 26.6 bits, see alignment (E = 7.7e-10) PF08459: UvrC_RNaseH_dom" amino acids 443 to 602 (160 residues), 170.9 bits, see alignment E=4e-54 PF14520: HHH_5" amino acids 619 to 667 (49 residues), 32.4 bits, see alignment 2.1e-11

Best Hits

Swiss-Prot: 66% identical to UVRC_MAGSA: UvrABC system protein C (uvrC) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 93% identity to azl:AZL_015490)

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (672 amino acids)

>MPMX19_01070 UvrABC system protein C (Azospirillum sp. SherDot2)
MSETHSSDPLDSPSADDAADGFAEDRLAEDGLTDLAAPTDAVPVGEGATARPKRRPADIN
RGVEIIREHLKTLPQTPGVYRMLAGDGAVLYVGKARNLKRRVTNYTQVGKLPVRLQRMVA
ETETMEFVNTHTEVEALLLESNLIKKLMPRYNVLLRDDKTFPHIMITKDHDYPQLTKHRG
ARGRDADYFGPFASAGAVNRTITALQRAFLLRNCADTVFAARTRPCLQFQIKRCTAPCVG
RVSPVEYQAQVNQARAFLSGKSRDIQTEFADRMMAASDAMDFETAARYRDRIRALTAIQA
HQDINVEGVVEDADVIAAYAEGGVTCIQVFFFRGGRNYGNRAYFPSHDKAAETEEVLAAF
IAQFYENKAAPPLVLVSHALPELELLSEALAVRAGHKVELAEPKRGEKRRIVEHALTNAR
EAHGRRLAESSSQARLLEGVAAVFGMDSAPERVEVYDNSHIQGAHAIGGMIVAGPEGFIK
NAYRKFNIRTEGAAGDDFAMMREVLTRRFGRAVKEDPERSLGSWPDLVLIDGGLGQLNVA
LEVFAELGIDDVTLVGIAKGPDRDAGREHFFMENRPPFQMEMRDPVLYFLQRLRDEAHRF
AIGTHRAKRTKAIGKSPIDEIAGIGPARKKALLHHFGSGAAVARAGLADLEAVEGINRTV
AKKIYDHFHPDG