Protein Info for MPMX19_01008 in Azospirillum sp. SherDot2

Annotation: Glutamate--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 TIGR00464: glutamate--tRNA ligase" amino acids 3 to 462 (460 residues), 514.5 bits, see alignment E=1.4e-158 PF00749: tRNA-synt_1c" amino acids 3 to 305 (303 residues), 319.4 bits, see alignment E=2.2e-99 PF19269: Anticodon_2" amino acids 337 to 464 (128 residues), 118.6 bits, see alignment E=3e-38

Best Hits

Swiss-Prot: 72% identical to SYE2_RHOCS: Glutamate--tRNA ligase 2 (gltX2) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 95% identity to azl:AZL_016080)

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.17

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>MPMX19_01008 Glutamate--tRNA ligase (Azospirillum sp. SherDot2)
MTVVTRFAPSPTGFLHIGGGRTALFNWLYARNTGGQFLLRIEDTDRQRSTDAAVDAIIDG
LKWLGLDWDGDAVSQFERKDRHAEVAYQMLAAGKAYRCYCSPEELEEMRAAQKAAGQPMR
YDGRWRDRPESDAPAGVAPVIRLKAPQEGQTVLNDLVQGEVTVQNAQLDDLILLRADGTP
TYLLAVVVDDHDMGVTHVIRGDDHLTNTFRQIQIFNSMGWELPRFGHIPLIHGPDGAKLS
KRHGALGVDAYRDMGYLPEAVRNYLLRLGWSHGDDEIISTEQAIEWFNLESIGRSASRFD
FAKLENLNAHYMRLADDFRLLGLIAPRLEADLGHGLSEAERDLLTRAMNGLKQRARTVVD
LAQSARFYVAPQPLSYDEKATALLDEKGRTLLRELAAAFAAEPEFTAAALESQVRAFAEA
RGEKLGKVAQPLRAALTGSTVSPPIFEVAELLGREATLSRIRDAAGAA