Protein Info for MPMX19_00971 in Azospirillum sp. SherDot2
Annotation: putative acyl-CoA thioester hydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to YCIA_SALTY: Acyl-CoA thioester hydrolase YciA (yciA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 98% identity to azl:AZL_016420)MetaCyc: 53% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]
Predicted SEED Role
"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle
MetaCyc Pathways
- firefly bioluminescence (2/14 steps found)
- jasmonic acid biosynthesis (4/19 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Fatty acid biosynthesis
- Limonene and pinene degradation
- Ubiquinone and menaquinone biosynthesis
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 3.1.2.-
Use Curated BLAST to search for 3.1.2.- or 3.1.2.20
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (131 amino acids)
>MPMX19_00971 putative acyl-CoA thioester hydrolase (Azospirillum sp. SherDot2) MSAADVYDFDNGPALRAIAMPADTNPNGDIFGGWLLAQMDLAGGTVAVRRSHGRVATVGI EAMTFHKPVFVGDEVSCFARIEKVGRTSLRVRIETWVRRERSGSDPIKVTEGVFTYVAIG EDRKPREVPPE